![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
![]() | Protein automated matches [226850] (21 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [225328] (6 PDB entries) |
![]() | Domain d2e37b2: 2e37 B:142-310 [204061] Other proteins in same PDB: d2e37a1, d2e37b1, d2e37c1, d2e37d1, d2e37e1, d2e37f1, d2e37g1, d2e37h1 automated match to d1llda2 complexed with nad, so4 |
PDB Entry: 2e37 (more details), 2.3 Å
SCOPe Domain Sequences for d2e37b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e37b2 d.162.1.0 (B:142-310) automated matches {Thermus thermophilus [TaxId: 300852]} tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf
Timeline for d2e37b2: