Class a: All alpha proteins [46456] (290 folds) |
Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) automatically mapped to Pfam PF01466 |
Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
Protein automated matches [226933] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries) |
Domain d2e31b2: 2e31 B:85-155 [204057] Other proteins in same PDB: d2e31b1 automated match to d1p22b1 |
PDB Entry: 2e31 (more details), 2.4 Å
SCOPe Domain Sequences for d2e31b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e31b2 a.157.1.1 (B:85-155) automated matches {Human (Homo sapiens) [TaxId: 9606]} ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd fteeeeaqvrk
Timeline for d2e31b2: