SCOPe 2.08: Domain d2e31b2: 2e31 B:85-155

Lineage for d2e31b2 (2e31 B:85-155)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)

6. Protein automated matches [226933] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)

8. Domain d2e31b2: 2e31 B:85-155 [204057]
   Other proteins in same PDB: d2e31b1
   automated match to d1p22b1

Details for d2e31b2

PDB Entry: 2e31, 2.4 Å

PDB Description: Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase

PDB Compounds: (B:) S-phase kinase-associated protein 1A

SCOPe Domain Sequences for d2e31b2:

Sequence; same for both SEQRES and ATOM records:

>d2e31b2 a.157.1.1 (B:85-155) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrk

Timeline for d2e31b2:

• d2e31b2 first appeared in SCOPe 2.03
  
• d2e31b2 appears in SCOPe 2.07