SCOPe 2.08: Domain d2e31b1: 2e31 B:2-65

Lineage for d2e31b1 (2e31 B:2-65)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)

8. Domain d2e31b1: 2e31 B:2-65 [204056]
   Other proteins in same PDB: d2e31b2
   automated match to d2ovra2

Details for d2e31b1

PDB Entry: 2e31, 2.4 Å

PDB Description: Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase

PDB Compounds: (B:) S-phase kinase-associated protein 1A

SCOPe Domain Sequences for d2e31b1:

Sequence, based on SEQRES records:

>d2e31b1 d.42.1.0 (B:2-65) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviqw
cthh

Sequence, based on observed residues (ATOM records):

>d2e31b1 d.42.1.0 (B:2-65) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgdpvplpnvnaailkkviqwcthh

Timeline for d2e31b1:

• d2e31b1 first appeared in SCOPe 2.03
  
• d2e31b1 appears in SCOPe 2.07