SCOPe 2.07: Domain d2e27l_: 2e27 L:

Lineage for d2e27l_ (2e27 L:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d2e27l_: 2e27 L: [204055]
   Other proteins in same PDB: d2e27h_
   automated match to d1fvcc_
   complexed with ab0, dms, gol

Details for d2e27l_

PDB Entry: 2e27, 1.7 Å

PDB Description: Crystal structure of Fv fragment of anti-ciguatoxin antibody complexed with ABC-ring of ciguatoxin

PDB Compounds: (L:) anti-ciguatoxin antibody, light chain

SCOPe Domain Sequences for d2e27l_:

Sequence; same for both SEQRES and ATOM records:

>d2e27l_ b.1.1.0 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqmtqspsslsaslggkvtitckanqdikkkiawyqhkpgkgprlliyytstlksgissr
fsgsgsgrdysfsisnlepedaatyyclqydnftwtfgggtkleikr

Timeline for d2e27l_:

• d2e27l_ first appeared in SCOPe 2.03
  
• d2e27l_ appears in SCOPe 2.06
  
• d2e27l_ appears in the current release, SCOPe 2.08