Lineage for d2e27h_ (2e27 H:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347951Species Mouse (Mus musculus) [TaxId:10090] [186842] (160 PDB entries)
  8. 2347956Domain d2e27h_: 2e27 H: [204054]
    Other proteins in same PDB: d2e27l_
    automated match to d1oayh_
    complexed with ab0, dms, gol

Details for d2e27h_

PDB Entry: 2e27 (more details), 1.7 Å

PDB Description: Crystal structure of Fv fragment of anti-ciguatoxin antibody complexed with ABC-ring of ciguatoxin
PDB Compounds: (H:) anti-ciguatoxin antibody, heavy chain

SCOPe Domain Sequences for d2e27h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e27h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqllesgaelarpgasvklsckasgytfttywmqwvrqrpgqglewigaiypgngdtry
sqkfkgkatltadtssstasmqlsslasedsavyycarsdyggdywgqgtsvtvss

SCOPe Domain Coordinates for d2e27h_:

Click to download the PDB-style file with coordinates for d2e27h_.
(The format of our PDB-style files is described here.)

Timeline for d2e27h_: