SCOPe 2.08: Domain d2e27h_: 2e27 H:

Lineage for d2e27h_ (2e27 H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2e27h_: 2e27 H: [204054]
   Other proteins in same PDB: d2e27l_
   automated match to d1oayh_
   complexed with ab0, dms, gol

Details for d2e27h_

PDB Entry: 2e27, 1.7 Å

PDB Description: Crystal structure of Fv fragment of anti-ciguatoxin antibody complexed with ABC-ring of ciguatoxin

PDB Compounds: (H:) anti-ciguatoxin antibody, heavy chain

SCOPe Domain Sequences for d2e27h_:

Sequence; same for both SEQRES and ATOM records:

>d2e27h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqllesgaelarpgasvklsckasgytfttywmqwvrqrpgqglewigaiypgngdtry
sqkfkgkatltadtssstasmqlsslasedsavyycarsdyggdywgqgtsvtvss

Timeline for d2e27h_:

• d2e27h_ first appeared in SCOPe 2.03
  
• d2e27h_ appears in SCOPe 2.07