Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (25 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225227] (1 PDB entry) |
Domain d2dy0b_: 2dy0 B: [204050] automated match to d1g2qa_ complexed with mg |
PDB Entry: 2dy0 (more details), 1.25 Å
SCOPe Domain Sequences for d2dy0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dy0b_ c.61.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} ataqqleylknsiksiqdypkpgilfrdvtslledpkayalsidllveryknagitkvvg teargflfgapvalglgvgfvpvrkpgklpretisetydleygtdqleihvdaikpgdkv lvvddllatggtieatvklirrlggevadaafiinlfdlggeqrlekqgitsyslvpfpg h
Timeline for d2dy0b_: