Lineage for d2dy0a_ (2dy0 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863464Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1863465Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1863901Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 1863902Protein automated matches [190891] (25 species)
    not a true protein
  7. 1863967Species Escherichia coli K-12 [TaxId:83333] [225227] (1 PDB entry)
  8. 1863968Domain d2dy0a_: 2dy0 A: [204049]
    automated match to d1g2qa_
    complexed with mg

Details for d2dy0a_

PDB Entry: 2dy0 (more details), 1.25 Å

PDB Description: Crystal structure of project JW0458 from Escherichia coli
PDB Compounds: (A:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d2dy0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dy0a_ c.61.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tataqqleylknsiksiqdypkpgilfrdvtslledpkayalsidllveryknagitkvv
gteargflfgapvalglgvgfvpvrkpgklpretisetydleygtdqleihvdaikpgdk
vlvvddllatggtieatvklirrlggevadaafiinlfdlggeqrlekqgitsyslvpfp
gh

SCOPe Domain Coordinates for d2dy0a_:

Click to download the PDB-style file with coordinates for d2dy0a_.
(The format of our PDB-style files is described here.)

Timeline for d2dy0a_: