Lineage for d2dwqa2 (2dwq A:284-368)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1404106Superfamily d.15.10: TGS-like [81271] (3 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
  5. 1404130Family d.15.10.0: automated matches [227173] (1 protein)
    not a true family
  6. 1404131Protein automated matches [226888] (2 species)
    not a true protein
  7. 1404134Species Thermus thermophilus [TaxId:300852] [225078] (2 PDB entries)
  8. 1404136Domain d2dwqa2: 2dwq A:284-368 [204044]
    Other proteins in same PDB: d2dwqa1, d2dwqb1
    automated match to d1jala2

Details for d2dwqa2

PDB Entry: 2dwq (more details), 2.95 Å

PDB Description: Thermus thermophilus YchF GTP-binding protein
PDB Compounds: (A:) GTP-binding protein

SCOPe Domain Sequences for d2dwqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dwqa2 d.15.10.0 (A:284-368) automated matches {Thermus thermophilus [TaxId: 300852]}
lltfftagekevrawtvrrgtkapraageihsdmergfiraevipwdklveaggwarake
rgwvrlegkdyevqdgdviyvlfna

SCOPe Domain Coordinates for d2dwqa2:

Click to download the PDB-style file with coordinates for d2dwqa2.
(The format of our PDB-style files is described here.)

Timeline for d2dwqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dwqa1