Lineage for d2dwqa1 (2dwq A:1-283)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114798Species Thermus thermophilus HB8 [TaxId:300852] [189850] (10 PDB entries)
  8. 2114807Domain d2dwqa1: 2dwq A:1-283 [204043]
    Other proteins in same PDB: d2dwqa2, d2dwqb2
    automated match to d1jala1

Details for d2dwqa1

PDB Entry: 2dwq (more details), 2.95 Å

PDB Description: Thermus thermophilus YchF GTP-binding protein
PDB Compounds: (A:) GTP-binding protein

SCOPe Domain Sequences for d2dwqa1:

Sequence, based on SEQRES records: (download)

>d2dwqa1 c.37.1.0 (A:1-283) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mlavgivglpnvgkstlfnaltranalaanypfatidknvgvvplederlyalqrtfakg
ervppvvpthvefvdiaglvkgahkgeglgnqflahirevaaiahvlrcfpdpdvvhvmg
rvdpledaevvetellladlatlerrlerlrkearadrerlplleaaeglyvhlqegkpa
rtfppseavarflketplltakpviyvanvaeedlpdgrgnpqveavrrkaleegaevvv
vsarleaelaelsgeearellaayglqesglqrlaragyrald

Sequence, based on observed residues (ATOM records): (download)

>d2dwqa1 c.37.1.0 (A:1-283) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mlavgivglpnvgkstlfnaltranalaatidknvgvvplederlyalqrtfakgervpp
vvpthvefvdiaglvkgahkgeglgnqflahirevaaiahvlrcfpdpdpledaevvete
llladlatlerrlerlrkearadrerlplleaaeglyvhlqegkpartfppseavarflk
etplltakpviyvanvaeedlpdgrgnpqveavrrkaleegaevvvvsarleaelaelsg
eearellaayglqesglqrlaragyrald

SCOPe Domain Coordinates for d2dwqa1:

Click to download the PDB-style file with coordinates for d2dwqa1.
(The format of our PDB-style files is described here.)

Timeline for d2dwqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dwqa2