SCOPe 2.03: Domain d2dvva_: 2dvv A:

Lineage for d2dvva_ (2dvv A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (145 PDB entries)

8. Domain d2dvva_: 2dvv A: [204042]
   automated match to d1x0jb_
   complexed with epe

Details for d2dvva_

PDB Entry: 2dvv, 1.8 Å

PDB Description: Crystal structure of the second bromodomain of the human Brd2 protein

PDB Compounds: (A:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d2dvva_:

Sequence; same for both SEQRES and ATOM records:

>d2dvva_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkm
enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd

Timeline for d2dvva_:

• d2dvva_ is new in SCOPe 2.03-stable
  
• d2dvva_ appears in SCOPe 2.04
  
• d2dvva_ appears in the current release, SCOPe 2.08, called d2dvva1