SCOPe 2.08: Domain d2dvva1: 2dvv A:348-455

Lineage for d2dvva1 (2dvv A:348-455)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d2dvva1: 2dvv A:348-455 [204042]
   Other proteins in same PDB: d2dvva2
   automated match to d1x0jb_
   complexed with epe

Details for d2dvva1

PDB Entry: 2dvv, 1.8 Å

PDB Description: Crystal structure of the second bromodomain of the human Brd2 protein

PDB Compounds: (A:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d2dvva1:

Sequence; same for both SEQRES and ATOM records:

>d2dvva1 a.29.2.0 (A:348-455) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmenrd
yrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd

Timeline for d2dvva1:

• d2dvva1 first appeared in SCOPe 2.03, called d2dvva_
  
• d2dvva1 appears in SCOPe 2.07