Lineage for d2dsad2 (2dsa D:81-200)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1736416Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1736417Protein automated matches [226831] (51 species)
    not a true protein
  7. 1736508Species Burkholderia xenovorans [TaxId:266265] [225116] (2 PDB entries)
  8. 1736512Domain d2dsad2: 2dsa D:81-200 [204041]
    Other proteins in same PDB: d2dsaa1, d2dsab1, d2dsac1, d2dsad1
    automated match to d1n2aa1
    complexed with gsh, hpx

Details for d2dsad2

PDB Entry: 2dsa (more details), 2.1 Å

PDB Description: Ternary complex of BphK, a bacterial GST
PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d2dsad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dsad2 a.45.1.0 (D:81-200) automated matches {Burkholderia xenovorans [TaxId: 266265]}
qlapangsferyhlqqwlnfisselhksfsplfnpassdewknavrqslntrlgqvarql
ehapyllgdqlsvadiylfvvlgwsayvnidlspwpslqafqgrvggreavqsalraegl

SCOPe Domain Coordinates for d2dsad2:

Click to download the PDB-style file with coordinates for d2dsad2.
(The format of our PDB-style files is described here.)

Timeline for d2dsad2: