Lineage for d2dsad1 (2dsa D:1-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879334Species Burkholderia xenovorans [TaxId:266265] [225115] (2 PDB entries)
  8. 2879338Domain d2dsad1: 2dsa D:1-80 [204040]
    Other proteins in same PDB: d2dsaa2, d2dsab2, d2dsac2, d2dsad2
    automated match to d1n2aa2
    complexed with gsh, hpx

Details for d2dsad1

PDB Entry: 2dsa (more details), 2.1 Å

PDB Description: Ternary complex of BphK, a bacterial GST
PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d2dsad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dsad1 c.47.1.0 (D:1-80) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mklyyspgacslsphialreaglnfelvqvdlaskktasgqdylevnpagyvpclqlddg
rtltegpaivqyvadqvpgk

SCOPe Domain Coordinates for d2dsad1:

Click to download the PDB-style file with coordinates for d2dsad1.
(The format of our PDB-style files is described here.)

Timeline for d2dsad1: