![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (195 species) not a true protein |
![]() | Species Burkholderia xenovorans [TaxId:266265] [225115] (2 PDB entries) |
![]() | Domain d2dsad1: 2dsa D:1-80 [204040] Other proteins in same PDB: d2dsaa2, d2dsab2, d2dsac2, d2dsad2 automated match to d1n2aa2 complexed with gsh, hpx |
PDB Entry: 2dsa (more details), 2.1 Å
SCOPe Domain Sequences for d2dsad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dsad1 c.47.1.0 (D:1-80) automated matches {Burkholderia xenovorans [TaxId: 266265]} mklyyspgacslsphialreaglnfelvqvdlaskktasgqdylevnpagyvpclqlddg rtltegpaivqyvadqvpgk
Timeline for d2dsad1: