SCOPe 2.08: Domain d2dsab2: 2dsa B:81-200

Lineage for d2dsab2 (2dsa B:81-200)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [225116] (2 PDB entries)

8. Domain d2dsab2: 2dsa B:81-200 [204037]
   Other proteins in same PDB: d2dsaa1, d2dsab1, d2dsac1, d2dsad1
   automated match to d1n2aa1
   complexed with gsh, hpx

Details for d2dsab2

PDB Entry: 2dsa, 2.1 Å

PDB Description: Ternary complex of BphK, a bacterial GST

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d2dsab2:

Sequence; same for both SEQRES and ATOM records:

>d2dsab2 a.45.1.0 (B:81-200) automated matches {Burkholderia xenovorans [TaxId: 266265]}
qlapangsferyhlqqwlnfisselhksfsplfnpassdewknavrqslntrlgqvarql
ehapyllgdqlsvadiylfvvlgwsayvnidlspwpslqafqgrvggreavqsalraegl

Timeline for d2dsab2:

• d2dsab2 first appeared in SCOPe 2.03
  
• d2dsab2 appears in SCOPe 2.07