Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily) unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432 |
Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) |
Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins) |
Protein Calcium ATPase [81658] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (42 PDB entries) Uniprot P04191 |
Domain d2dqsa4: 2dqs A:361-599 [204031] Other proteins in same PDB: d2dqsa1, d2dqsa2, d2dqsa3 automated match to d1wpga3 complexed with acp, mg, na, pty, tg1 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2dqs (more details), 2.5 Å
SCOPe Domain Sequences for d2dqsa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dqsa4 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm
Timeline for d2dqsa4: