SCOPe 2.07: Domain d2dqsa3: 2dqs A:344-360,A:600-750

Lineage for d2dqsa3 (2dqs A:344-360,A:600-750)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 proteins)
   interrupted by a large insertion, domain N

6. Protein Calcium ATPase, catalytic domain P [81655] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (43 PDB entries)
   Uniprot P04191

8. Domain d2dqsa3: 2dqs A:344-360,A:600-750 [204030]
   Other proteins in same PDB: d2dqsa1, d2dqsa2, d2dqsa4
   automated match to d1wpga2
   complexed with acp, mg, na, pty, tg1

Details for d2dqsa3

PDB Entry: 2dqs, 2.5 Å

PDB Description: Crystal structure of the calcium pump with amppcp in the absence of calcium

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d2dqsa3:

Sequence; same for both SEQRES and ATOM records:

>d2dqsa3 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

Timeline for d2dqsa3:

• d2dqsa3 first appeared in SCOPe 2.03
  
• d2dqsa3 appears in SCOPe 2.06
  
• d2dqsa3 appears in the current release, SCOPe 2.08