Lineage for d1bz7b1 (1bz7 B:1-122)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510801Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 1510825Domain d1bz7b1: 1bz7 B:1-122 [20403]
    Other proteins in same PDB: d1bz7a1, d1bz7a2, d1bz7b2
    part of humanized Fab R24 from murine ascites

Details for d1bz7b1

PDB Entry: 1bz7 (more details), 2.5 Å

PDB Description: fab fragment from murine ascites
PDB Compounds: (B:) protein (antibody r24 (heavy chain))

SCOPe Domain Sequences for d1bz7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
dvqlvesggglvqpggsrklscaasgftfsnfgmhwvrqapekglewvayissggssiny
adtvkgrftisrdnpkntlflqmtslrsedtaiyyctrggtgtrslyyfdywgqgatliv
ss

SCOPe Domain Coordinates for d1bz7b1:

Click to download the PDB-style file with coordinates for d1bz7b1.
(The format of our PDB-style files is described here.)

Timeline for d1bz7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bz7b2