SCOP 1.55: Domain d1bz7b1: 1bz7 B:1-122

Lineage for d1bz7b1 (1bz7 B:1-122)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab R24, (mouse), kappa L chain [48884] (2 PDB entries)

8. Domain d1bz7b1: 1bz7 B:1-122 [20403]
   Other proteins in same PDB: d1bz7a2, d1bz7b2

Details for d1bz7b1

PDB Entry: 1bz7, 2.5 Å

PDB Description: fab fragment from murine ascites

SCOP Domain Sequences for d1bz7b1:

Sequence; same for both SEQRES and ATOM records:

>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin (variable domains of L and H chains) {Fab R24, (mouse), kappa L chain}
dvqlvesggglvqpggsrklscaasgftfsnfgmhwvrqapekglewvayissggssiny
adtvkgrftisrdnpkntlflqmtslrsedtaiyyctrggtgtrslyyfdywgqgatliv
ss

Timeline for d1bz7b1:

• d1bz7b1 appears in SCOP 1.57
  
• d1bz7b1 appears in the current release, SCOPe 2.08