SCOPe 2.08: Domain d2dpla1: 2dpl A:1-189

Lineage for d2dpla1 (2dpl A:1-189)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (28 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [311263] (4 PDB entries)

8. Domain d2dpla1: 2dpl A:1-189 [204019]
   Other proteins in same PDB: d2dpla2, d2dplb2
   automated match to d1gpma1

Details for d2dpla1

PDB Entry: 2dpl, 1.43 Å

PDB Description: Crystal Structure of the GMP synthase from Pyrococcus horikoshii OT3

PDB Compounds: (A:) GMP synthase [glutamine-hydrolyzing] subunit B

SCOPe Domain Sequences for d2dpla1:

Sequence, based on SEQRES records:

>d2dpla1 c.26.2.0 (A:1-189) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mdwgrfveekvreiretvgdskaiialsggvdsstaavlahkaigdrlhavfvntgflrk
gepefvvktfrdefgmnlhyvdaqdrffsalkgvtdpeekrkiigrvfievfeevakkig
aeyliqgtiapdwiesqgkikshhnvgglpeklnlklieplrdlykdevrelakflglpe
kiynrmpfp

Sequence, based on observed residues (ATOM records):

>d2dpla1 c.26.2.0 (A:1-189) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mdwgrfveekvreiretvgdskaiialsggvdsstaavlahkaigdrlhavfvntgflrk
gepefvvktfrdefgmnlhyvdaqdrffsalkgvtdpeekrkiigrvfievfeevakkig
aeyliqgtiaplnlklieplrdlykdevrelakflglpekiynrmpfp

Timeline for d2dpla1:

• d2dpla1 first appeared in SCOPe 2.03
  
• d2dpla1 appears in SCOPe 2.07