Lineage for d2diea2 (2die A:396-485)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2077462Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2077463Protein automated matches [226835] (34 species)
    not a true protein
  7. 2077485Species Bacillus sp. [225223] (1 PDB entry)
  8. 2077486Domain d2diea2: 2die A:396-485 [204018]
    Other proteins in same PDB: d2diea1
    automated match to d1ud2a1
    complexed with ca, na

Details for d2diea2

PDB Entry: 2die (more details), 2.1 Å

PDB Description: Alkaline alpha-amylase AmyK from Bacillus sp. KSM-1378
PDB Compounds: (A:) amylase

SCOPe Domain Sequences for d2diea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2diea2 b.71.1.0 (A:396-485) automated matches {Bacillus sp.}
yaygtqhdyfdhhdiigwtregdsshpnsglatimsdgpggnkwmyvgkhkagqvwrdit
gnrsgtvtinadgwgnftvnggavsvwvkq

SCOPe Domain Coordinates for d2diea2:

Click to download the PDB-style file with coordinates for d2diea2.
(The format of our PDB-style files is described here.)

Timeline for d2diea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2diea1