SCOPe 2.03: Domain d2diea2: 2die A:396-485

Lineage for d2diea2 (2die A:396-485)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (18 species)
   not a true protein

7. Species Bacillus sp. [225223] (1 PDB entry)

8. Domain d2diea2: 2die A:396-485 [204018]
   Other proteins in same PDB: d2diea1
   automated match to d1ud2a1
   complexed with ca, na

Details for d2diea2

PDB Entry: 2die, 2.1 Å

PDB Description: Alkaline alpha-amylase AmyK from Bacillus sp. KSM-1378

PDB Compounds: (A:) amylase

SCOPe Domain Sequences for d2diea2:

Sequence; same for both SEQRES and ATOM records:

>d2diea2 b.71.1.0 (A:396-485) automated matches {Bacillus sp.}
yaygtqhdyfdhhdiigwtregdsshpnsglatimsdgpggnkwmyvgkhkagqvwrdit
gnrsgtvtinadgwgnftvnggavsvwvkq

Timeline for d2diea2:

• d2diea2 is new in SCOPe 2.03-stable
  
• d2diea2 appears in SCOPe 2.04
  
• d2diea2 appears in the current release, SCOPe 2.08