Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (33 species) not a true protein |
Species Bacillus sp. [225222] (1 PDB entry) |
Domain d2diea1: 2die A:5-395 [204017] Other proteins in same PDB: d2diea2 automated match to d1ud2a2 complexed with ca, na |
PDB Entry: 2die (more details), 2.1 Å
SCOPe Domain Sequences for d2diea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2diea1 c.1.8.1 (A:5-395) automated matches {Bacillus sp.} tngtmmqyfewhlpndgnhwnrlrddaanlkskgitavwippawkgtsqndvgygaydly dlgefnqkgtvrtkygtrsqlqgavtslknngiqvygdvvmnhkggadgtemvnavevnr snrnqeisgeytieawtkfdfpgrgnthsnfkwrwyhfdgtdwdqsrqlqnkiykfrgtg kawdwevdiengnydylmyadidmdhpevinelrnwgvwytntlnldgfridavkhikys ytrdwlthvrnttgkpmfavaefwkndlaaienylnktswnhsvfdvplhynlynasnsg gyfdmrnilngsvvqkhpihavtfvdnhdsqpgealesfvqswfkplayaliltreqgyp svfygdyygipthgvpsmkskidpllqarqt
Timeline for d2diea1: