Lineage for d2diea1 (2die A:5-395)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818157Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1818647Protein automated matches [190099] (22 species)
    not a true protein
  7. 1818668Species Bacillus sp. [225222] (1 PDB entry)
  8. 1818669Domain d2diea1: 2die A:5-395 [204017]
    Other proteins in same PDB: d2diea2
    automated match to d1ud2a2
    complexed with ca, na

Details for d2diea1

PDB Entry: 2die (more details), 2.1 Å

PDB Description: Alkaline alpha-amylase AmyK from Bacillus sp. KSM-1378
PDB Compounds: (A:) amylase

SCOPe Domain Sequences for d2diea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2diea1 c.1.8.1 (A:5-395) automated matches {Bacillus sp.}
tngtmmqyfewhlpndgnhwnrlrddaanlkskgitavwippawkgtsqndvgygaydly
dlgefnqkgtvrtkygtrsqlqgavtslknngiqvygdvvmnhkggadgtemvnavevnr
snrnqeisgeytieawtkfdfpgrgnthsnfkwrwyhfdgtdwdqsrqlqnkiykfrgtg
kawdwevdiengnydylmyadidmdhpevinelrnwgvwytntlnldgfridavkhikys
ytrdwlthvrnttgkpmfavaefwkndlaaienylnktswnhsvfdvplhynlynasnsg
gyfdmrnilngsvvqkhpihavtfvdnhdsqpgealesfvqswfkplayaliltreqgyp
svfygdyygipthgvpsmkskidpllqarqt

SCOPe Domain Coordinates for d2diea1:

Click to download the PDB-style file with coordinates for d2diea1.
(The format of our PDB-style files is described here.)

Timeline for d2diea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2diea2