Lineage for d2dhha3 (2dhh A:135-181,A:274-330)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955661Superfamily d.58.44: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82693] (1 family) (S)
    duplication: the N- and C-terminal halves of the whole proteins are structurally similar; each half contains two domains of this fold
  5. 2955662Family d.58.44.1: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82694] (1 protein)
  6. 2955663Protein Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82695] (1 species)
    PN2 and PC2 subdomains are interrupted by the inserted subdomains DN and DC, respectively
  7. 2955664Species Escherichia coli [TaxId:562] [82696] (7 PDB entries)
  8. 2955674Domain d2dhha3: 2dhh A:135-181,A:274-330 [203995]
    Other proteins in same PDB: d2dhha1, d2dhha4, d2dhha5, d2dhha8, d2dhhb1, d2dhhb4, d2dhhb5, d2dhhb8, d2dhhc1, d2dhhc4, d2dhhc5, d2dhhc8
    automated match to d1iwga2

Details for d2dhha3

PDB Entry: 2dhh (more details), 2.8 Å

PDB Description: Crystal structure of a multidrug transporter reveal a functionally rotating mechanism
PDB Compounds: (A:) AcrB

SCOPe Domain Sequences for d2dhha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dhha3 d.58.44.1 (A:135-181,A:274-330) Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains {Escherichia coli [TaxId: 562]}
sflmvvgvintdgtmtqedisdyvaanmkdaisrtsgvgdvqlfgsqXnydiiaefngqp
asglgiklatganaldtaaairaelakmepffpsglkivypydtt

SCOPe Domain Coordinates for d2dhha3:

Click to download the PDB-style file with coordinates for d2dhha3.
(The format of our PDB-style files is described here.)

Timeline for d2dhha3: