Lineage for d43caf_ (43ca F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740504Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 2740543Domain d43caf_: 43ca F: [20399]
    Other proteins in same PDB: d43caa_, d43cac_, d43cae_, d43cag_
    part of sterolytic and amidolytic Fv 43c9
    complexed with npo

Details for d43caf_

PDB Entry: 43ca (more details), 2.3 Å

PDB Description: crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol
PDB Compounds: (F:) protein (immunoglobulin (heavy chain))

SCOPe Domain Sequences for d43caf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d43caf_ b.1.1.1 (F:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
qvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsieyn
palksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs

SCOPe Domain Coordinates for d43caf_:

Click to download the PDB-style file with coordinates for d43caf_.
(The format of our PDB-style files is described here.)

Timeline for d43caf_: