SCOPe 2.04: Domain d2dfdd2: 2dfd D:151-319

Lineage for d2dfdd2 (2dfd D:151-319)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225057] (2 PDB entries)

8. Domain d2dfdd2: 2dfd D:151-319 [203984]
   Other proteins in same PDB: d2dfda1, d2dfdb1, d2dfdc1, d2dfdd1
   automated match to d1mlda2
   complexed with ala, cl, his, mlt, nad

Details for d2dfdd2

PDB Entry: 2dfd, 1.9 Å

PDB Description: Crystal Structure of Human Malate Dehydrogenase Type 2

PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d2dfdd2:

Sequence; same for both SEQRES and ATOM records:

>d2dfdd2 d.162.1.1 (D:151-319) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vttldivrantfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltg
riqeagtevvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyf
stplllgkkgieknlgigkvssfeekmisdaipelkasikkgedfvktl

Timeline for d2dfdd2:

• d2dfdd2 first appeared in SCOPe 2.03
  
• d2dfdd2 appears in SCOPe 2.05
  
• d2dfdd2 appears in the current release, SCOPe 2.08