Lineage for d2dfdc1 (2dfd C:6-150)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844864Protein automated matches [226881] (8 species)
    not a true protein
  7. 2844882Species Human (Homo sapiens) [TaxId:9606] [225056] (8 PDB entries)
  8. 2844885Domain d2dfdc1: 2dfd C:6-150 [203981]
    Other proteins in same PDB: d2dfda2, d2dfdb2, d2dfdc2, d2dfdd2
    automated match to d1mlda1
    complexed with ala, cl, his, mlt, nad

Details for d2dfdc1

PDB Entry: 2dfd (more details), 1.9 Å

PDB Description: Crystal Structure of Human Malate Dehydrogenase Type 2
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d2dfdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dfdc1 c.2.1.5 (C:6-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
vnstipitaevfkkhgvynpnkifg

SCOPe Domain Coordinates for d2dfdc1:

Click to download the PDB-style file with coordinates for d2dfdc1.
(The format of our PDB-style files is described here.)

Timeline for d2dfdc1: