SCOPe 2.06: Domain d2dfdb1: 2dfd B:6-150

Lineage for d2dfdb1 (2dfd B:6-150)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225056] (7 PDB entries)

8. Domain d2dfdb1: 2dfd B:6-150 [203979]
   Other proteins in same PDB: d2dfda2, d2dfdb2, d2dfdc2, d2dfdd2
   automated match to d1mlda1
   complexed with ala, cl, his, mlt, nad

Details for d2dfdb1

PDB Entry: 2dfd, 1.9 Å

PDB Description: Crystal Structure of Human Malate Dehydrogenase Type 2

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d2dfdb1:

Sequence; same for both SEQRES and ATOM records:

>d2dfdb1 c.2.1.5 (B:6-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
vnstipitaevfkkhgvynpnkifg

Timeline for d2dfdb1:

• d2dfdb1 first appeared in SCOPe 2.03
  
• d2dfdb1 appears in SCOPe 2.05
  
• d2dfdb1 appears in SCOPe 2.07
  
• d2dfdb1 appears in the current release, SCOPe 2.08