SCOPe 2.06: Domain d2df8b_: 2df8 B:

Lineage for d2df8b_ (2df8 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.0: automated matches [191405] (1 protein)
   not a true family

6. Protein automated matches [190547] (15 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [193200] (3 PDB entries)

8. Domain d2df8b_: 2df8 B: [203976]
   automated match to d2decb_
   complexed with edo, f1p

Details for d2df8b_

PDB Entry: 2df8, 1.5 Å

PDB Description: crystal structure of the ph0510 protein from pyrococcus horikoshii ot3 in complex with beta-d-fructopyranose-1-phosphate

PDB Compounds: (B:) 325aa long hypothetical protein

SCOPe Domain Sequences for d2df8b_:

Sequence; same for both SEQRES and ATOM records:

>d2df8b_ c.80.1.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
ktlieikqtpdgiikadkvfnkvkdkislpnrilylgcgsshflskllamvtnmhgglgi
alpcseflysketypigevelavgisrsgetteillalekinvkklgittressltrmcd
yslvvpaieesvvmthsftsfyfaylqllrysyglpplnageiskateksleyeryirei
vesfdfqniiflgsgllypvaleaslkmkemsifwseayptfevrhgfkaiadektlvvl
mveepfewheklvkefknqgakvlvisnspqdlgqdysielprlskdanpipylpivqll
syykavsrglnpdnprfldkvvrw

Timeline for d2df8b_:

• d2df8b_ first appeared in SCOPe 2.03
  
• d2df8b_ appears in SCOPe 2.05
  
• d2df8b_ appears in SCOPe 2.07
  
• d2df8b_ appears in the current release, SCOPe 2.08