Lineage for d2deja2 (2dej A:179-350)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954566Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954707Family d.58.26.0: automated matches [227186] (1 protein)
    not a true family
  6. 2954708Protein automated matches [226908] (6 species)
    not a true protein
  7. 2954724Species Pyrococcus horikoshii [TaxId:53953] [225135] (3 PDB entries)
  8. 2954726Domain d2deja2: 2dej A:179-350 [203974]
    Other proteins in same PDB: d2deja1
    automated match to d1s4ed2
    complexed with apw, gla

Details for d2deja2

PDB Entry: 2dej (more details), 1.5 Å

PDB Description: crystal structure of galaktokinase from pyrococcus horikoshii with amp-pn and galactose
PDB Compounds: (A:) Probable galactokinase

SCOPe Domain Sequences for d2deja2:

Sequence, based on SEQRES records: (download)

>d2deja2 d.58.26.0 (A:179-350) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
dvsilvfytgvrrelasseyaerkhiaeeslkilgkgsskevregelsklpplhrkffgy
ivrenarvlevrdalkegnveevgkilttahwdlaknyevsckeldffveralklgayga
rltgagfggsaialvdkedaetigeeilreylkrfpwkarhfivepsdgvgi

Sequence, based on observed residues (ATOM records): (download)

>d2deja2 d.58.26.0 (A:179-350) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
dvsilvfytgvrsseyaerkhiaeeslkilgkgsskevregelsklpplhrkffgyivre
narvlevrdalkegnveevgkilttahwdlaknyevsckeldffveralklgaygarltg
agfggsaialvdkedaetigeeilreylkrfpwkarhfivepsdgvgi

SCOPe Domain Coordinates for d2deja2:

Click to download the PDB-style file with coordinates for d2deja2.
(The format of our PDB-style files is described here.)

Timeline for d2deja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2deja1