SCOPe 2.08: Domain d2deja1: 2dej A:1-178

Lineage for d2deja1 (2dej A:1-178)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (23 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [225134] (3 PDB entries)

8. Domain d2deja1: 2dej A:1-178 [203973]
   Other proteins in same PDB: d2deja2
   automated match to d1s4ed1
   complexed with apw, gla

Details for d2deja1

PDB Entry: 2dej, 1.5 Å

PDB Description: crystal structure of galaktokinase from pyrococcus horikoshii with amp-pn and galactose

PDB Compounds: (A:) Probable galactokinase

SCOPe Domain Sequences for d2deja1:

Sequence; same for both SEQRES and ATOM records:

>d2deja1 d.14.1.0 (A:1-178) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mikvkspgrvnligehtdytygyvmpmainlytkieaekhgevilysehfgeerkfslnd
lrkenswidyvkgifwvlkesdyevggikgrvsgnlplgaglsssasfevgiletldkly
nlkldslskvllakkaenefvgvpcgildqfavvfgregnvifldthtldyeyipfpk

Timeline for d2deja1:

• d2deja1 first appeared in SCOPe 2.03
  
• d2deja1 appears in SCOPe 2.07