Lineage for d2deja1 (2dej A:1-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931144Species Pyrococcus horikoshii [TaxId:53953] [225134] (3 PDB entries)
  8. 2931146Domain d2deja1: 2dej A:1-178 [203973]
    Other proteins in same PDB: d2deja2
    automated match to d1s4ed1
    complexed with apw, gla

Details for d2deja1

PDB Entry: 2dej (more details), 1.5 Å

PDB Description: crystal structure of galaktokinase from pyrococcus horikoshii with amp-pn and galactose
PDB Compounds: (A:) Probable galactokinase

SCOPe Domain Sequences for d2deja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2deja1 d.14.1.0 (A:1-178) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mikvkspgrvnligehtdytygyvmpmainlytkieaekhgevilysehfgeerkfslnd
lrkenswidyvkgifwvlkesdyevggikgrvsgnlplgaglsssasfevgiletldkly
nlkldslskvllakkaenefvgvpcgildqfavvfgregnvifldthtldyeyipfpk

SCOPe Domain Coordinates for d2deja1:

Click to download the PDB-style file with coordinates for d2deja1.
(The format of our PDB-style files is described here.)

Timeline for d2deja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2deja2