SCOPe 2.06: Domain d2deia1: 2dei A:1-178

Lineage for d2deia1 (2dei A:1-178)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (17 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [225134] (3 PDB entries)

8. Domain d2deia1: 2dei A:1-178 [203971]
   Other proteins in same PDB: d2deia2
   automated match to d1s4ed1
   complexed with gla, map

Details for d2deia1

PDB Entry: 2dei, 1.7 Å

PDB Description: crystal structure of galaktokinase from pyrococcus horikoshii with amp-pnp and galactose

PDB Compounds: (A:) Probable galactokinase

SCOPe Domain Sequences for d2deia1:

Sequence; same for both SEQRES and ATOM records:

>d2deia1 d.14.1.0 (A:1-178) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mikvkspgrvnligehtdytygyvmpmainlytkieaekhgevilysehfgeerkfslnd
lrkenswidyvkgifwvlkesdyevggikgrvsgnlplgaglsssasfevgiletldkly
nlkldslskvllakkaenefvgvpcgildqfavvfgregnvifldthtldyeyipfpk

Timeline for d2deia1:

• d2deia1 first appeared in SCOPe 2.03
  
• d2deia1 appears in SCOPe 2.05
  
• d2deia1 appears in SCOPe 2.07
  
• d2deia1 appears in the current release, SCOPe 2.08