![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
![]() | Protein automated matches [190826] (23 species) not a true protein |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [225134] (3 PDB entries) |
![]() | Domain d2deia1: 2dei A:1-178 [203971] Other proteins in same PDB: d2deia2 automated match to d1s4ed1 complexed with gla, map |
PDB Entry: 2dei (more details), 1.7 Å
SCOPe Domain Sequences for d2deia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2deia1 d.14.1.0 (A:1-178) automated matches {Pyrococcus horikoshii [TaxId: 53953]} mikvkspgrvnligehtdytygyvmpmainlytkieaekhgevilysehfgeerkfslnd lrkenswidyvkgifwvlkesdyevggikgrvsgnlplgaglsssasfevgiletldkly nlkldslskvllakkaenefvgvpcgildqfavvfgregnvifldthtldyeyipfpk
Timeline for d2deia1: