Lineage for d43cac_ (43ca C:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 783027Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (36 PDB entries)
  8. 783053Domain d43cac_: 43ca C: [20396]
    Other proteins in same PDB: d43cab_, d43cad_, d43caf_, d43cah_
    part of sterolytic and amidolytic Fv 43c9

Details for d43cac_

PDB Entry: 43ca (more details), 2.3 Å

PDB Description: crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol
PDB Compounds: (C:) protein (immunoglobulin (light chain))

SCOP Domain Sequences for d43cac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d43cac_ b.1.1.1 (C:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik

SCOP Domain Coordinates for d43cac_:

Click to download the PDB-style file with coordinates for d43cac_.
(The format of our PDB-style files is described here.)

Timeline for d43cac_: