SCOP 1.59: Domain d43cac_: 43ca C:

Lineage for d43cac_ (43ca C:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain [48883] (2 PDB entries)

8. Domain d43cac_: 43ca C: [20396]

Details for d43cac_

PDB Entry: 43ca, 2.3 Å

PDB Description: crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol

SCOP Domain Sequences for d43cac_:

Sequence; same for both SEQRES and ATOM records:

>d43cac_ b.1.1.1 (C:) Immunoglobulin (variable domains of L and H chains) {Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain}
dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik

Timeline for d43cac_:

• d43cac_ first appeared (with stable ids) in SCOP 1.55
  
• d43cac_ appears in SCOP 1.57
  
• d43cac_ appears in SCOP 1.61
  
• d43cac_ appears in the current release, SCOPe 2.08