Lineage for d2ddac1 (2dda C:4-154)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577754Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 2577755Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 2577787Family d.111.1.0: automated matches [227200] (1 protein)
    not a true family
  6. 2577788Protein automated matches [226929] (4 species)
    not a true protein
  7. 2577791Species Pseudechis australis [TaxId:8670] [225217] (1 PDB entry)
  8. 2577794Domain d2ddac1: 2dda C:4-154 [203957]
    Other proteins in same PDB: d2ddaa2, d2ddab2, d2ddac2, d2ddad2
    automated match to d1rc9a1
    complexed with fmt, gol, na

Details for d2ddac1

PDB Entry: 2dda (more details), 2.25 Å

PDB Description: Crystal structure of pseudechetoxin from Pseudechis australis
PDB Compounds: (C:) Pseudechetoxin

SCOPe Domain Sequences for d2ddac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddac1 d.111.1.0 (C:4-154) automated matches {Pseudechis australis [TaxId: 8670]}
knyqkeivdkhnalrrsvkptarnmlqmkwnsraaqnakrwanrctfahsppnkrtvgkl
rcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwyksyligcas
akcssskylyvcqycpagnirgsiatpyksg

SCOPe Domain Coordinates for d2ddac1:

Click to download the PDB-style file with coordinates for d2ddac1.
(The format of our PDB-style files is described here.)

Timeline for d2ddac1: