| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.111: PR-1-like [55796] (1 superfamily) alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342 |
Superfamily d.111.1: PR-1-like [55797] (2 families) ![]() |
| Family d.111.1.0: automated matches [227200] (1 protein) not a true family |
| Protein automated matches [226929] (2 species) not a true protein |
| Species Pseudechis australis [TaxId:8670] [225217] (1 PDB entry) |
| Domain d2ddac1: 2dda C:4-154 [203957] Other proteins in same PDB: d2ddaa2, d2ddab2, d2ddac2, d2ddad2 automated match to d1rc9a1 complexed with fmt, gol, na |
PDB Entry: 2dda (more details), 2.25 Å
SCOPe Domain Sequences for d2ddac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ddac1 d.111.1.0 (C:4-154) automated matches {Pseudechis australis [TaxId: 8670]}
knyqkeivdkhnalrrsvkptarnmlqmkwnsraaqnakrwanrctfahsppnkrtvgkl
rcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwyksyligcas
akcssskylyvcqycpagnirgsiatpyksg
Timeline for d2ddac1: