| Class b: All beta proteins [48724] (174 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
| Protein Xylanase II [49979] (18 species) Partial overlap with common fold and the active sites of the other endoglucanases |
| Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries) |
| Domain d2dcza_: 2dcz A: [203951] automated match to d2b42b_ complexed with dio, so4 |
PDB Entry: 2dcz (more details), 1.9 Å
SCOPe Domain Sequences for d2dcza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dcza_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywhfwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgcs
nvtvw
Timeline for d2dcza_: