![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [225088] (3 PDB entries) |
![]() | Domain d2dc5a2: 2dc5 A:93-225 [203948] Other proteins in same PDB: d2dc5a1, d2dc5a3, d2dc5b1, d2dc5b3 automated match to d1bg5a1 |
PDB Entry: 2dc5 (more details), 1.6 Å
SCOPe Domain Sequences for d2dc5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dc5a2 a.45.1.0 (A:93-225) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lcgeteeerirvdilenqlmdnrmvlarlcynadfeklkpgyleqlpgmmrlyseflgkr pwfagdkitfvdfiaydvlernqvfeakcldafpnlkdfiarfeglkkisdymktsrflp rpmftkmatwgsn
Timeline for d2dc5a2: