SCOPe 2.08: Domain d2dc5a1: 2dc5 A:9-92

Lineage for d2dc5a1 (2dc5 A:9-92)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries)

8. Domain d2dc5a1: 2dc5 A:9-92 [203947]
   Other proteins in same PDB: d2dc5a2, d2dc5a3, d2dc5b2, d2dc5b3
   automated match to d1m9aa2

Details for d2dc5a1

PDB Entry: 2dc5, 1.6 Å

PDB Description: Crystal structure of mouse glutathione S-transferase, mu7 (GSTM7) at 1.6 A resolution

PDB Compounds: (A:) Glutathione S-transferase, mu 7

SCOPe Domain Sequences for d2dc5a1:

Sequence; same for both SEQRES and ATOM records:

>d2dc5a1 c.47.1.0 (A:9-92) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pmtlgywdirglahairlfleytdssyeekrytmgdapdydqsqwlnekfklgldfpnlp
ylidgshkitqsnailrylgrkhn

Timeline for d2dc5a1:

• d2dc5a1 first appeared in SCOPe 2.03
  
• d2dc5a1 appears in SCOPe 2.07