Lineage for d2dc5a1 (2dc5 A:9-92)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879989Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries)
  8. 2879991Domain d2dc5a1: 2dc5 A:9-92 [203947]
    Other proteins in same PDB: d2dc5a2, d2dc5a3, d2dc5b2, d2dc5b3
    automated match to d1m9aa2

Details for d2dc5a1

PDB Entry: 2dc5 (more details), 1.6 Å

PDB Description: Crystal structure of mouse glutathione S-transferase, mu7 (GSTM7) at 1.6 A resolution
PDB Compounds: (A:) Glutathione S-transferase, mu 7

SCOPe Domain Sequences for d2dc5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dc5a1 c.47.1.0 (A:9-92) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pmtlgywdirglahairlfleytdssyeekrytmgdapdydqsqwlnekfklgldfpnlp
ylidgshkitqsnailrylgrkhn

SCOPe Domain Coordinates for d2dc5a1:

Click to download the PDB-style file with coordinates for d2dc5a1.
(The format of our PDB-style files is described here.)

Timeline for d2dc5a1: