![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Cytoglobin [109626] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [109627] (8 PDB entries) Uniprot Q8WWM9 18-171 |
![]() | Domain d2dc3b_: 2dc3 B: [203946] automated match to d1v5ha_ complexed with acy, hem |
PDB Entry: 2dc3 (more details), 1.68 Å
SCOPe Domain Sequences for d2dc3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dc3b_ a.1.1.2 (B:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]} vpgemeierrerseelseaerkavqamwarlyancedvgvailvrffvnfpsakqyfsqf khmedplemerspqlrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvy fkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgw
Timeline for d2dc3b_: