SCOPe 2.03: Domain d2dc3b_: 2dc3 B:

Lineage for d2dc3b_ (2dc3 B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Cytoglobin [109626] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109627] (8 PDB entries)
   Uniprot Q8WWM9 18-171

8. Domain d2dc3b_: 2dc3 B: [203946]
   automated match to d1v5ha_
   complexed with acy, hem

Details for d2dc3b_

PDB Entry: 2dc3, 1.68 Å

PDB Description: Crystal structure of human cytoglobin at 1.68 angstroms resolution

PDB Compounds: (B:) cytoglobin

SCOPe Domain Sequences for d2dc3b_:

Sequence; same for both SEQRES and ATOM records:

>d2dc3b_ a.1.1.2 (B:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}
vpgemeierrerseelseaerkavqamwarlyancedvgvailvrffvnfpsakqyfsqf
khmedplemerspqlrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvy
fkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgw

Timeline for d2dc3b_:

• d2dc3b_ is new in SCOPe 2.03-stable
  
• d2dc3b_ appears in SCOPe 2.04
  
• d2dc3b_ appears in the current release, SCOPe 2.08