Lineage for d2dc3b_ (2dc3 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2685987Protein Cytoglobin [109626] (1 species)
  7. 2685988Species Human (Homo sapiens) [TaxId:9606] [109627] (8 PDB entries)
    Uniprot Q8WWM9 18-171
  8. 2685990Domain d2dc3b_: 2dc3 B: [203946]
    automated match to d1v5ha_
    complexed with acy, hem

Details for d2dc3b_

PDB Entry: 2dc3 (more details), 1.68 Å

PDB Description: Crystal structure of human cytoglobin at 1.68 angstroms resolution
PDB Compounds: (B:) cytoglobin

SCOPe Domain Sequences for d2dc3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dc3b_ a.1.1.2 (B:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}
vpgemeierrerseelseaerkavqamwarlyancedvgvailvrffvnfpsakqyfsqf
khmedplemerspqlrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvy
fkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgw

SCOPe Domain Coordinates for d2dc3b_:

Click to download the PDB-style file with coordinates for d2dc3b_.
(The format of our PDB-style files is described here.)

Timeline for d2dc3b_: