SCOPe 2.04: Domain d2dbya2: 2dby A:284-366

Lineage for d2dbya2 (2dby A:284-366)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.10: TGS-like [81271] (3 families)
   possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif

5. Family d.15.10.0: automated matches [227173] (1 protein)
   not a true family

6. Protein automated matches [226888] (2 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225078] (2 PDB entries)

8. Domain d2dbya2: 2dby A:284-366 [203944]
   Other proteins in same PDB: d2dbya1
   automated match to d1jala2
   complexed with fmt, gdp

Details for d2dbya2

PDB Entry: 2dby, 1.76 Å

PDB Description: Crystal structure of the GTP-binding protein YchF in complexed with GDP

PDB Compounds: (A:) GTP-binding protein

SCOPe Domain Sequences for d2dbya2:

Sequence; same for both SEQRES and ATOM records:

>d2dbya2 d.15.10.0 (A:284-366) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
lltfftagekevrawtvrrgtkapraageihsdmergfiraevipwdklveaggwarake
rgwvrlegkdyevqdgdviyvlf

Timeline for d2dbya2:

• d2dbya2 first appeared in SCOPe 2.03
  
• d2dbya2 appears in SCOPe 2.05
  
• d2dbya2 appears in the current release, SCOPe 2.08