Lineage for d2dbya2 (2dby A:284-366)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639789Superfamily d.15.10: TGS-like [81271] (3 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
  5. 1639813Family d.15.10.0: automated matches [227173] (1 protein)
    not a true family
  6. 1639814Protein automated matches [226888] (2 species)
    not a true protein
  7. 1639817Species Thermus thermophilus HB8 [TaxId:300852] [225078] (2 PDB entries)
  8. 1639818Domain d2dbya2: 2dby A:284-366 [203944]
    Other proteins in same PDB: d2dbya1
    automated match to d1jala2
    complexed with fmt, gdp

Details for d2dbya2

PDB Entry: 2dby (more details), 1.76 Å

PDB Description: Crystal structure of the GTP-binding protein YchF in complexed with GDP
PDB Compounds: (A:) GTP-binding protein

SCOPe Domain Sequences for d2dbya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dbya2 d.15.10.0 (A:284-366) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
lltfftagekevrawtvrrgtkapraageihsdmergfiraevipwdklveaggwarake
rgwvrlegkdyevqdgdviyvlf

SCOPe Domain Coordinates for d2dbya2:

Click to download the PDB-style file with coordinates for d2dbya2.
(The format of our PDB-style files is described here.)

Timeline for d2dbya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dbya1