Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.10: TGS-like [81271] (3 families) possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif |
Family d.15.10.0: automated matches [227173] (1 protein) not a true family |
Protein automated matches [226888] (3 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225078] (2 PDB entries) |
Domain d2dbya2: 2dby A:284-366 [203944] Other proteins in same PDB: d2dbya1 automated match to d1jala2 complexed with fmt, gdp |
PDB Entry: 2dby (more details), 1.76 Å
SCOPe Domain Sequences for d2dbya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dbya2 d.15.10.0 (A:284-366) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} lltfftagekevrawtvrrgtkapraageihsdmergfiraevipwdklveaggwarake rgwvrlegkdyevqdgdviyvlf
Timeline for d2dbya2: