![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (58 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [189850] (8 PDB entries) |
![]() | Domain d2dbya1: 2dby A:1-283 [203943] Other proteins in same PDB: d2dbya2 automated match to d1jala1 complexed with fmt, gdp |
PDB Entry: 2dby (more details), 1.76 Å
SCOPe Domain Sequences for d2dbya1:
Sequence, based on SEQRES records: (download)
>d2dbya1 c.37.1.0 (A:1-283) automated matches {Thermus thermophilus [TaxId: 300852]} mlavgivglpnvgkstlfnaltranalaanypfatidknvgvvplederlyalqrtfakg ervppvvpthvefvdiaglvkgahkgeglgnqflahirevaaiahvlrcfpdpdvvhvmg rvdpledaevvetellladlatlerrlerlrkearadrerlplleaaeglyvhlqegkpa rtfppseavarflketplltakpviyvanvaeedlpdgrgnpqveavrrkaleegaevvv vsarleaelaelsgeearellaayglqesglqrlaragyrald
>d2dbya1 c.37.1.0 (A:1-283) automated matches {Thermus thermophilus [TaxId: 300852]} mlavgivglpnvgkstlfnaltranalaanypfatidknvgvvplederlyalqrtfakg ervppvvpthvefvdiaglvkgahkgeglgnqflahirevaaiahvlrcfpdpledaevv etellladlatlerrlerlrkearadrerlplleaaeglyvhlqegkpartfppseavar flketplltakpviyvanvaeedlpdgrgnpqveavrrkaleegaevvvvsarleaelae lsgeearellaayglqesglqrlaragyrald
Timeline for d2dbya1: