SCOPe 2.06: Domain d2d7tl1: 2d7t L:1-108

Lineage for d2d7tl1 (2d7t L:1-108)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)

8. Domain d2d7tl1: 2d7t L:1-108 [203942]
   Other proteins in same PDB: d2d7th_, d2d7tl2
   automated match to d1fvcc_

Details for d2d7tl1

PDB Entry: 2d7t, 1.7 Å

PDB Description: Crystal structure of human anti polyhydroxybutyrate antibody Fv

PDB Compounds: (L:) anti polyhydroxybutyrate antibody Fv, light chain

SCOPe Domain Sequences for d2d7tl1:

Sequence; same for both SEQRES and ATOM records:

>d2d7tl1 b.1.1.1 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspsslsasvgdrvtitcrasqninnylhwyqhepgkapklliyaasnlqggvts
rfsgsgsgtdftltistlqpedfatyyclqthaypltfgggtkvdikr

Timeline for d2d7tl1:

• d2d7tl1 first appeared in SCOPe 2.03, called d2d7tl_
  
• d2d7tl1 was called d2d7tl_ in SCOPe 2.05
  
• d2d7tl1 appears in SCOPe 2.07
  
• d2d7tl1 appears in the current release, SCOPe 2.08