Lineage for d2d7tl_ (2d7t L:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1512787Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)
  8. 1512820Domain d2d7tl_: 2d7t L: [203942]
    Other proteins in same PDB: d2d7th_
    automated match to d1fvcc_

Details for d2d7tl_

PDB Entry: 2d7t (more details), 1.7 Å

PDB Description: Crystal structure of human anti polyhydroxybutyrate antibody Fv
PDB Compounds: (L:) anti polyhydroxybutyrate antibody Fv, light chain

SCOPe Domain Sequences for d2d7tl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7tl_ b.1.1.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspsslsasvgdrvtitcrasqninnylhwyqhepgkapklliyaasnlqggvts
rfsgsgsgtdftltistlqpedfatyyclqthaypltfgggtkvdikraa

SCOPe Domain Coordinates for d2d7tl_:

Click to download the PDB-style file with coordinates for d2d7tl_.
(The format of our PDB-style files is described here.)

Timeline for d2d7tl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d7th_