Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d2d7th_: 2d7t H: [203941] Other proteins in same PDB: d2d7tl1, d2d7tl2 automated match to d4jvpa_ |
PDB Entry: 2d7t (more details), 1.7 Å
SCOPe Domain Sequences for d2d7th_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d7th_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvqsgaevkkpgasvkvsckasgytftgnymhwvrqapgqgleymgwinpksgdtny aqkfqgrvtmtrdtsistvymevrrlrsddtavyycatgwwgmdvwgqgtlvtvss
Timeline for d2d7th_: