SCOPe 2.05: Domain d2d7th_: 2d7t H:

Lineage for d2d7th_ (2d7t H:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2d7th_: 2d7t H: [203941]
   Other proteins in same PDB: d2d7tl_
   automated match to d4jvpa_

Details for d2d7th_

PDB Entry: 2d7t, 1.7 Å

PDB Description: Crystal structure of human anti polyhydroxybutyrate antibody Fv

PDB Compounds: (H:) anti polyhydroxybutyrate antibody Fv, heavy chain

SCOPe Domain Sequences for d2d7th_:

Sequence; same for both SEQRES and ATOM records:

>d2d7th_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgasvkvsckasgytftgnymhwvrqapgqgleymgwinpksgdtny
aqkfqgrvtmtrdtsistvymevrrlrsddtavyycatgwwgmdvwgqgtlvtvss

Timeline for d2d7th_:

• d2d7th_ first appeared in SCOPe 2.03
  
• d2d7th_ appears in SCOPe 2.04
  
• d2d7th_ appears in SCOPe 2.06
  
• d2d7th_ appears in the current release, SCOPe 2.08